Vraag Het CORONA-virus. Nieuwtjes en UPDATES

Meer
4 maanden 2 weken geleden #56024 door katertje
Inbreng Geert Wilders corona-debat (26-03-2020)

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 2 weken geleden #56019 door katertje
Kamerleden zijn vanmorgen bijgepraat door het RIVM en de Nederlandse Vereniging voor Intensive Care over de laatste ontwikkelingen rond het coronavirus. Hoe staan we er als Nederland voor?

Het coronavirus heeft inmiddels 356 levens geëist in Nederland. Dat zijn 80 overledenen meer dan een dag eerder bekend was. Het Rijksinstituut voor Volksgezondheid en Milieu (RIVM) maakte de laatste cijfers woensdagmiddag bekend.

Het aantal ziekenhuisopnamen is met 341 gestegen. Sinds het begin van de uitbraak zijn volgens de gegevens van het instituut in totaal 1.836 mensen met het virus opgenomen in het ziekenhuis. Woensdag lagen er volgens ramingen van het RIVM ongeveer 600 patiënten op de IC. Inmiddels is bij 6.412 mensen in Nederland vastgesteld dat ze zijn besmet met het coronavirus. De afgelopen 24 uur kwamen er 852 meldingen van positieve tests bij.

Volgens Jaap van Dissel van het RIVM lijkt de verspreiding van het coronavirus in Nederland af te remmen. Van Dissel benadrukt dat alle ontwikkelingen erg gevoelig zijn voor de mate waarin mensen zich aan de maatregelen houden die door het kabinet zijn afgekondigd.
Die ontwikkeling is te danken aan de maatregelen die zijn genomen om de opmars van het virus te stoppen. Met name het maandag afgekondigde voorschrift dat alle huisgenoten van een zieke met bijvoorbeeld koorts thuis moeten blijven. Die maatregel, ‘die we misschien nog meer op de voorgrond moeten zetten’, geeft nu mogelijk het laatste zetje waardoor de intensive care afdelingen van de ziekenhuizen de uitbraak aankunnen.
Zonder de maatregelen van maandag zouden er vermoedelijk te veel mensen tegelijk ziek worden en zou er te weinig plaats zijn op de intensive care van de ziekenhuizen. De groei van het aantal coronapatiënten vlakt volgens de ramingen die het RIVM gebruikt nu waarschijnlijk zo af dat de ic’s genoeg bedden hebben voor de toestromende patiënten.
De volledige presentatie van Jaap van Dissel voor Tweede Kamerleden kunt u hier nog eens rustig terugkijken

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 2 weken geleden #56014 door katertje


Grote zorgen bij Philips. Het concern vreest dat de Amerikanen beademingsapparatuur gaan opeisen. Philips produceert de zorgapparaten in de Verenigde Staten. Door een wet uit de jaren 50 dreigt de VS beademingsapparatuur te confisqueren. De druk op president Trump om die wet in te zetten nam maandag fors toe vanwege het in razend tempo stijgende aantal Amerikaanse coronapatiënten.

Apparaten die onder meer voor de Europese markt zouden zijn bestemd, zouden in dat geval in Amerika worden gehouden.

Daarmee ligt er een uiterst gevoelig internationaal handelsconflict op de loer. Trump activeerde de wet zelf vorige week maar gaf toen aan die alleen in het uiterste geval te gebruiken. Inmiddels is er een luide roep van Amerikaanse democraten en medici om vérgaande acties.
De zogenaamde Defence Production Act is in 1950 in het leven geroepen om staal van de auto-industrie te kunnen vorderen voor nieuwe tanks tijdens de Korea-oorlog.

Veel bestellingen
Wereldwijd is er behoefte aan vele tienduizenden beademingsmachines, die essentieel zijn voor de behandeling van ernstige zieke coronapatiënten. Alleen al het Nederlandse kabinet heeft bestellingen geplaatst voor 2000 apparaten, zei Martin van Rijn, de nieuwe minister voor Medische zorg, maandagavond. Omdat onduidelijk is wanneer die kunnen worden geleverd, zijn extra bestellingen geplaatst. Volgens de minister wordt er gewerkt aan het opzetten van eigen productiecapaciteit in Nederland. Daarvoor wordt volgens Van Rijn onder meer met Philips gesproken.

Onbegonnen werk
Philips-topman Frans van Houten zei maandag dat alle regeringen momenteel een eigen fabriek voor beademingsapparatuur willen hebben. Dat is volgens hem bijna onbegonnen werk omdat voor de productie veel specialistische componenten nodig zijn. Aan de hand van een lijst van de Wereldgezondheidsorganisatie levert het concern apparatuur aan landen en regio's waar ziekenhuizen worden geconfronteerd met veel coronapatiënten. Eerst werd aan China geleverd, later aan Italië. Nu levert het concern aan Zwitserland, Frankrijk, Spanje en New York.
Philips gaat de productie de komende tijd flink verhogen. Binnen acht weken moet ie in de VS zijn verdubbeld. Tegen het derde kwartaal moet dat een verviervoudiging zijn. Philips neemt in de Amerikaanse fabrieken tientallen extra mensen aan.
bron: AD
Bijlagen:
De volgende gebruiker (s) zei dank u: dirko

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 2 weken geleden #56013 door katertje
Meerdere Nederlandse militairen in Litouwen besmet met coronavirus. Afgelopen nacht vijf soldaten door luchtmacht opgehaald.

Meer Nederlandse militairen die op uitzending zijn in Litouwen zijn besmet met het coronavirus. Maandag was er nog sprake van één militair, maar inmiddels gaat het om “enkele” militairen, laat minister Ank Bijleveld van Defensie aan de Tweede Kamer weten.

De gehele kazerne is inmiddels tot quarantainegebied verklaard. De afgelopen nacht zijn vijf Nederlandse militairen hier door de luchtmacht opgehaald. Een van hen was besmet en is opgenomen in het ziekenhuis in Utrecht. De andere vier zitten in quarantaine.

Verder heeft ook een Nederlandse waarnemer bij de United Nations Truce Supervision Organization (UNTSO) het coronavirus opgelopen. De militair heeft geen klachten. De UNTSO ziet toe op de wapenstilstand tussen Israël en Arabische landen.
De volgende gebruiker (s) zei dank u: dirko

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden #56007 door katertje
Plotseling was het daar, als een dief in de nacht, het Coronavirus dat Europa lam legt, plotseling? Toevallig? Een biowapen? We weten het niet, feit is dat het al geoefend was in oktober 2019 door de NWO (Nieuwe Wereld Orde) en nu tot uitvoering wordt gebracht.

Event 201-oefening
Event 201 was een 3,5 uur durende pandemische oefening die een reeks dramatische, op scenario’s gebaseerde, gefaciliteerde discussies simuleerde (nu in uitvoering maart 2020), waarbij levensechte dilemma’s werden gesimuleerd die verband zouden houden met de reactie op een hypothetische, maar wetenschappelijk plausibele pandemie. Vijftien wereldwijde leiders van het bedrijfsleven, de overheid en de volksgezondheid waren spelers in de simulatieoefening die onopgelost beleid en economische kwesties belichtten die nu en in de toekomst met voldoende politieke wil, financiële investeringen en aandacht kunnen worden opgelost.
De oefening bestond uit vooraf opgenomen nieuwsuitzendingen, live “personeels” -briefings en gemodereerde discussies over specifieke onderwerpen. Deze problemen zijn zorgvuldig ontworpen in een meeslepend verhaal dat de deelnemers en het publiek heeft opgeleid.
Het Johns Hopkins Center for Health Security, het World Economic Forum en de Bill & Melinda Gates Foundation waren de sponsors en initiefnemers van deze oefening

Evenement 201
Het Johns Hopkins Bloomberg Center for Health Security, in samenwerking met het World Economic Forum en de Bill and Melinda Gates Foundation, organiseerde Event 201, een pandemische oefening op hoog niveau op 18 oktober 2019 in New York, NY. De oefening illustreerde gebieden waar publiek-private partnerschappen nodig zullen zijn tijdens de reactie op een ernstige pandemie om de grootschalige economische en maatschappelijke gevolgen te verminderen.

Statement over nCoV (COVID-19) en de pandemische oefening 18 October 2019
“In de afgelopen jaren heeft de wereld een groeiend aantal epidemische gebeurtenissen meegemaakt, wat neerkomt op ongeveer 200 per jaar. Deze gebeurtenissen nemen toe en verstoren de gezondheid, de economie en de samenleving. Het beheer van deze gebeurtenissen belast de wereldwijde capaciteit, een pandemische dreiging. Deskundigen zijn het erover eens dat het slechts een kwestie van tijd is voordat een van deze epidemieën wereldwijd wordt: een pandemie met potentieel catastrofale gevolgen. Een ernstige pandemie, die “Event 201″ genoemd wordt, vereist betrouwbare samenwerking tussen verschillende industrieën, nationale regeringen en belangrijke internationale instellingen”.
Deze sessies werden opgenomen en hier te zien in vijf video’s.

Aanbevelingen
De volgende ernstige pandemie zal niet alleen leiden tot grote ziekte en levensverlies, maar kan ook leiden tot grote cascades van economische en maatschappelijke gevolgen die een grote bijdrage kunnen leveren aan de wereldwijde impact en het lijden. De pandemie-oefening Event 201, die op 18 oktober 2019 werd gehouden, toonde een aantal van deze belangrijke hiaten in de voorbereiding op de pandemie, evenals enkele elementen van de oplossingen tussen de publieke en de private sector die nodig zullen zijn om deze op te vullen. Het Johns Hopkins Center for Health Security, het World Economic Forum en de Bill & Melinda Gates Foundation stelden gezamenlijk deze aanbevelingen voor.
Boven genoemde organisaties behoren tot de NWO, de schaduwregering van de VS en de wereld die de media, farmaceutische industrie in handen hebben. Bloomberg en Bill Gates zijn de rijkste mannen ter wereld.

oneworld.press/?module=articles&action=view&id=1360
De volgende gebruiker (s) zei dank u: dirko

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden - 4 maanden 3 weken geleden #56004 door katertje
U had van mij nog de reactie tegoed van Graaf Lippens, al een jaar of 40 de burgemeester van buurgemeente Knokke-Heist. Werd wakker gemaakt met zijn tirade eergisteren op Omroep Zeeland. Zijn optreden wordt elke nieuwsuitzending op tv van Omroep Zeeland herhaald....Komt ie...

Belgische buurgemeente weert Nederlanders ;
'Jullie maatregelen zijn belachelijk!'
Burgemeester Leopold Lippens van Knokke-Heist, waar Nederlanders sinds vandaag geweerd worden vanwege het coronavirus, maakt zich kwaad over de lakse houding van Nederland.

"Nederlanders hebben er een handje van om te zeggen dat zij de beste zijn, de rijkste, de slimste. Maar wat Nederland nu doet is onaanvaardbaar! Uw regering is een stelletje onnozelaars!", zei hij vanmorgen op de radio.

Hij vindt dat de Nederlandse overheid weinig maatregelen neemt om de verspreiding van het coronavirus tegen te gaan. "Dit is belachelijk! Uw land heeft altijd de mond vol over dat u het zo goed voor elkaar heeft, maar de maatregelen in Nederland zijn een lachertje!"


Lippens pleit voor een zogeheten lockdown in Nederland, net als in België en meerdere andere Europese landen. Zolang dat niet het geval is, zijn we wat hem betreft in zijn gemeente niet meer welkom. En dus ook niet in het ziekenhuis AZ Zeno, waar normaal gesproken ook weleens Zeeuws-Vlaamse patiënten heen gaan.

"Ik zit niet te wachten op Nederlanders die hierheen komen en lopen te snoeven dat het in Nederland wel mee zal vallen. Dit is een internationaal virus en vereist een internationale aanpak. En dan moet je niet zoals in Nederland alles maar openhouden!", zei Lippens in het radioprogramma Zeeland wordt wakker.


Nederlanders die worden aangetroffen in de gemeente, bijvoorbeeld nadat ze zijn herkend aan hun nummerbord, moeten aantonen dat ze er zijn voor legitieme redenen, zoals voor hun werk. Zo niet dan krijgen ze volgens Lippens een boete. Een bezoek aan het ziekenhuis in Knokke is geen geldige reden, benadrukt hij. "Ik wil de Belgen verdedigen tegen de idioterie van Nederland", herhaalt hij.

De gemeente Knokke-Heist grenst aan Sluis, waar eerder juist maatregelen werden genomen om Belgen te weren. De Nederlandse maatregelen waren nodig omdat veel Belgen de grens over gingen nadat bij onze zuiderburen de cafés en restaurants dicht moesten, terwijl ze hier nog open waren. En later gebeurde hetzelfde met de winkels. In Nederland zijn de winkels nu nog altijd geopend. Cafés en restaurants zijn hier inmiddels ook dicht.
'Idioten'
Burgemeester Lippens noemt zijn de landgenoten die de grens over gaan 'idioten'. "Dat is echt levensgevaarlijk!", zegt hij. "Die mensen hebben geen burgerzin en zouden wat mij betreft een zware boete moeten krijgen." Volgens Lippens heeft de gemeente Sluis ook hulp gevraagd van de Belgische politie, om de grens beter te controleren.

In een reactie op Twitter ontkent burgemeester Marga Vermue van de Zeeuwse buurgemeente Sluis dat het ziekenhuis Zeeuwse patiënten weigert. "Alle patiënten, waar dan ook vandaan, blijven welkom in het ziekenhuis", schrijft ze na een gesprek met de directeur van het ziekenhuis.

> Opmerkelijk overigens dat asielzoekers gewoon mogen blijven komen en geen strobreed in de weg wordt gelegd. Zouden die immuun zijn?
Laast bewerkt: 4 maanden 3 weken geleden door katertje.

Gelieve Inloggen om deel te nemen aan het gesprek.

  • dirko
  • dirko's Profielfoto
  • Offline
  • Spammer
  • Spammer
  • Als iets niet kan, kan het tóch. Overste Ranft.
Meer
4 maanden 3 weken geleden #56003 door dirko
..
Wat velen allang dachten..:

www.rd.nl/opinie/lakse-overheden-oorzaak-coronacrisis-1.1643440

Het is al twintig jaar algemeen bekend dat een nieuwe stam van het coronavirus vroeg of laat een pandemie zou gaan veroorzaken. De huidige coronacrisis was te voorzien en ze werd al jarenlang verwacht. Waarom werd er dan geen actie ondernomen door regeringen en het WHO?

Coronavirussen zijn bekende luchtwegvirussen. Ze zijn de oorzaak van de meeste verkoudheden. In het algemeen zijn ze niet dodelijk. Toch kunnen ze ontsporen en een gevaar voor de volksgezondheid gaan vormen. De stam SARS-CoV was de eerste die ontspoorde en een bedreiging werd. Tijdens mijn bezoek in 2003 aan een congres van longspecialisten in Australië was er speciale aandacht voor SARS-CoV, dat destijds een ernstig ademhalingssyndroom (SARS) veroorzaakte. SARS had een sterftecijfer van 9 procent en werd gezien als een serieus gevaar voor de westerse samenleving. Gelukkig was SARS niet zo besmettelijk als gevreesd. Binnen enkele maanden was het virus verdwenen. Toch wist elke longspecialist dat dit niet het laatste dodelijke coronavirus zou zijn.

In 2012 stak het volgende coronavirus, MERS-CoV, de kop op. Met een sterftecijfer van boven de 30 procent was dit het meest agressieve coronavirus tot nu toe. Ook dit virus verdween weer zonder een pandemie te veroorzaken. Opnieuw wisten longspecialisten dat dit ook niet het laatste dodelijke coronavirus zou zijn.

Sinds 2019 is er het SARS-CoV2, het coronavirus dat Covid-19 veroorzaakt. Het heeft de pandemie veroorzaakt waar destijds iedereen bang voor was. Met een sterftecijfer van gemiddeld 3 tot 4 procent is SARS-CoV2 niet zo dodelijk als eerdere coronavirussen, maar wel veel besmettelijker. Daarom is het gevaarlijk voor de zwaksten van onze samenleving.

RNA-virus
Coronavirussen zijn RNA-virussen. Ze vinden hun oorsprong in het genoom van hogere organismen. Nieuwe stammen ontstaan voortdurend door recombinatie van RNA. Momenteel kennen we zeven soorten die de mens kunnen infecteren. Bij besmetting ontwikkelt de mens luchtweginfectiesademhalingssymptomen van verschillende ernst. Twee types, HCoV-229E en HCoV-OC43, veroorzaken verkoudheid. De andere coronavirussen kunnen leiden tot ernstigere luchtweginfecties en kunnen zelfs dodelijk zijn.

Tussen de uitbraak van SARS in 2003 en de uitbraak van Covid-19 ligt zeventien jaar. In deze jaren zagen Facebook, Snapchat en Amazon het licht. Virtual Reality, kunstmatige intelligentie en ”machine learning” werden ontwikkeld. Het menselijk DNA werd in kaart gebracht, evenals het genoom van meer dan 250 andere organismen. De genomen van honderden virussen, waaronder alle coronavirussen, werden eveneens ontrafeld en in kaart gebracht. Bovendien werd de genbewerkingstechnologie CRISPR-Cas ontwikkeld.

In zeventien jaar tijd zijn veel hightech-gadgets en technologieën ontwikkeld. Maar waar bleef in deze jaren een adequate behandeling tegen coronavirussen? Is er een vaccin ontwikkeld? Of een antilichaam? Alle kennis om dat te doen was aanwezig. En we wisten dat er een nieuwe uitbraak van het coronavirus zou komen, waarschijnlijk in China. Het schokkende feit is dat er niets is ontwikkeld om de volgende uitbraak van een dodelijk coronavirus te bestrijden. Helemaal niets!

Duizenden mensen stierven tijdens de corona-epidemieën van 2003 en 2013, omdat er verrassend genoeg geen vaccin, behandeling of diagnose was ontwikkeld. Anno 2020 doodt een coronavirus opnieuw duizenden mensen. Zeker, er is nu een diagnostische test beschikbaar. Maar een vaccin of behandeling is er nog steeds niet.

Het is bijna ongelooflijk. We kunnen ons echt afvragen waarom onze regeringen, onder leiding van de WHO, geen onderzoeks- en ontwikkelingsprogramma hebben opgezet om voorbereid te zijn op deze uitbraak. Dat zou geen grote wetenschappelijke opgave zijn geweest, en ook niet erg kostbaar.

Eiwitten
Alle dodelijke coronavirussen hebben zeer vergelijkbare moleculaire structuren. Hun virale genoom codeert voor verschillende eiwitten met unieke functies, waaronder een N-eiwit en een spike (S)-eiwit. Het N-eiwit, dat in alle agressieve coronastammen voorkomt, wordt momenteel gebruikt als een diagnostische ”marker”. Het S-eiwit is het beste doelwit bij de ontwikkeling van vaccins en virus-remmende antistoffen, omdat het S-eiwit nodig is om de cellen van het menselijk lichaam binnen te dringen.

Nieuwe studies hebben aangetoond dat Covid-19 dezelfde ACE2-receptor gebruikt om menselijke cellen te infecteren als het SARS-virus van 2003. Een op ACE2 gebaseerde behandeling voor SARS zou dus een behandeling voor Covid-19 zijn geweest. Tenminste, als die zou zijn ontwikkeld.

Onaangenaam
Net als SARS en MERS is Covid-19 een onaangename wake-up call voor onze slapende regeringen. Die hadden al lang geleden hun verantwoordelijkheid moeten nemen. Er was immers volop gelegenheid om behandelingen en vaccins te ontwikkelen om de Corona-crisis, die in feite zeventien jaar geleden is begonnen, te voorkomen.

Als ze naar coronadeskundigen hadden geluisterd, was er nu een oplossing geweest. Als ze enkele miljoenen hadden besteed aan preventief en curatief onderzoek, zou de wereld voorbereid zijn geweest op de coronacrisis. Sterker nog, er zou geen coronacrisis zijn geweest. Kennelijk hebben onze overheden ervoor gekozen om de ogen hiervoor te sluiten en het leven van duizenden mensen op het spel te zetten. Ze nemen zelfs het faillissement van het economische systeem op de koop toe. Maar het leven van de slachtoffers kan niet met geld worden vergoed.

De auteur werkte twintig jaar als moleculair bioloog aan luchtwegziekten en is auteur van ”Terug naar de Oorsprong” (2009) en ”Darwin Revisited” (2018).

...

De draad geheel kwijt. Soms Bang, maar altijd Olufsen.!!
De volgende gebruiker (s) zei dank u: katertje

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden #56000 door katertje
In Duitsland en Oostenrijk verstrekt de grootste gsm-operator van elk land de autoriteiten nu gebruikersgegevens zoals locatie-informatie – onder verwijzing naar de Coronapandemie.

Sveriges Radio radio meldt dat het Robert Koch-instituut – dat wil zeggen de Duitse federale overheidsinstantie en onderzoeksinstituut dat verantwoordelijk is voor ziektebestrijding en preventie – nu gegevens over de locatiegegevens van telefoons krijgt toegewezen door het telecommunicatiebedrijf Deutsche Telekom. Het is de bedoeling dat de overheidsinstantie voor infectiebescherming kan beoordelen of mensen de oproep tot quarantaine volgen.

Op dinsdagavond heeft de Deutsche Telekom vijf gigabyte aan informatie geleverd over hoe de klanten van het bedrijf met hun mobiele telefoon zich verplaatsen. De informatie, die naar verluidt is geanonimiseerd, zou het mogelijk moeten maken om in de hele Bondsrepubliek te traceren.

Het hoofd van het Robert Koch-instituut, Lothar Wiele, stelt dat het doel van de monitoring is om te kunnen vaststellen “of de bewegingen van mensen in de samenleving afnemen”.
“Als we kunnen zien dat mensen zich blijven bewegen en de verspreiding van de infectie tegelijkertijd doorgaat, dan weten we waarom”, zegt hij.
Soortgelijke maatregelen worden ook genomen in Oostenrijk, waar het telecommunicatiebedrijf A1 nu informatie verstrekt aan de Oostenrijkse autoriteiten. Deze autoriteiten hebben strenge regels voor quarantaine aangekondigd en iedereen die deze regels illegaal overtreedt, kan een boete krijgen. De manager van A1 had er echter voor moeten zorgen dat de gegevens die het bedrijf aan de autoriteiten verstrekt, geen identificatie van personen mogelijk maken.

In Duitsland hebben de autoriteiten zich tot nu toe tevreden gesteld met het adviseren van mensen om de socialisatie tot een minimum te beperken. Echter, op woensdagavond gaf Merkel een toespraak tot de republiek waarin ze aankondigde dat er ook in Duitsland strengere gedragsregels te verwachten zijn.

In haar toespraak tot het Duitse volk zei Merkel onder andere dat Duitsland nu het risiconiveau naar het volgende hoogste niveau tilt, dat er reisverboden zullen worden ingevoerd, dat er snel nieuwe specialistische ziekenhuizen in Berlijn zullen worden gebouwd en dat de corona-crisis “onze grootste uitdaging sinds de Tweede Wereldoorlog is”.

Merkel verklaarde ook dat wijzelf het belangrijkste instrument zijn in de strijd tegen het virus en ze deed een beroep op het verantwoordelijkheidsgevoel van de Duitsers:
“Ik ben ervan overtuigd dat we deze taak aankunnen als alle burgers het echt als hun persoonlijke taak zien.”
Merkel heeft echter niets gezegd over het feit dat de Duitse autoriteiten nu technische hulpmiddelen gebruiken om ervoor te zorgen dat de burgers verantwoordelijkheidsgevoel tonen.

> Voorbereidingen voor totale controle ! De oorlog op de eigen bevolking is geopend.

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden #55999 door katertje
Kamervragen van Wilders PVV aan Min.Pres. en de Min van VWS over de capaciteit van IC-units en beademingsapparaten in Nederland i.v.m. de Corona-pandemie

Bijlagen:

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden #55993 door katertje
Rutte sorteert voor op een vierde kabinet Rutte met de PvdA (en de communicerende holle vaten GroenLinks en D66)

Oud-staatssecretaris Martin van Rijn van de PvdA wordt de nieuwe minister voor Medische Zorg, heeft premier Rutte zojuist bekendgemaakt. Het is voor drie maanden en op verzoek van het kabinet, zegt Rutte. Van Rijn treedt op persoonlijke titel toe tot het kabinet.

Hij volgt VVD'er Bruno Bruins op, die gisteren ontslag nam vanwege ernstige oververmoeidheid. Rutte is blij dat Van Rijn ja heeft gezegd "omdat hij meteen beschikbaar is en ik enorm veel vertrouwen in hem heb".

Van Rijn is goed ingevoerd in de zorgsector. Hij is nu voorzitter van de raad van bestuur van de Reinier Hagagroep, met ziekenhuizen in Den Haag, Delft en Zoetermeer. In het kabinet-Rutte II was hij samen met minister Schippers verantwoordelijk voor grote veranderingen en bezuinigingen in de zorg.
Zo loodste hij de Wet langdurige zorg en een nieuwe Wet maatschappelijke ondersteuning door het parlement.
Rutte reageerde geïrriteerd op vragen van een journalist over het beleid van Van Rijn in het vorige kabinet als PvdA-staatssecretaris van Volksgezondheid.

Het is de afgelopen decennia niet voorgekomen dat een voormalige bewindspersoon van een oppositiepartij lid werd van een kabinet. Rutte: "Deze crisis is zo groot, partijkleur maakt nu even niet uit."

PvdA-leider Asscher denkt er ook zo over. "Als er een nationale crisis is dan help je waar je kan. Ik ben trots op iedereen die in deze moeilijke tijd naar voren stapt. Veel succes, Martin van Rijn."
Ook de VVD-fractie reageert positief. Fractievoorzitter Dijkhoff: "In deze tijd van crisis is er geen tijd om in te werken. Martin heeft de kennis en ervaring op VWS om direct bij te dragen aan het onder controle houden van het coronavirus."

> Van Rijn heeft zich onder Rutte laten verleiden tot het voeren van een beleid dat zéér nadelig is geweest voor de hele zorgsector - wat overigens door de trouwe PvdA-stemmers keihard is afgestraft .Zijn WMO is uitgedraaid op een regelrechte ramp en voor de Jeugdwet geldt hetzelfde. Maar die nachtmerrie raakt alleen de mensen die van deze wetten afhankelijk zijn. De rest heeft geen idéé. Voor de schatkist zijn deze wetten een zegen.
Het hoofdpijn ministerie gaat dus naar “de vijand”. Slim bekeken.
Overigens zei Rutte dat hij een van de beste krachten was in zijn kabinet. Dat zegt genoeg toch! We wachten af!

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden - 4 maanden 3 weken geleden #55992 door katertje
Brabantse ziekenhuizen slaan alarm: 'Elke drie dagen verdubbelt aantal patiënten'

Ziekenhuizen in de provincie Noord-Brabant vrezen de stroom aan coronapatiënten over één tot twee weken niet meer aan te kunnen. Ze doen daarom een dringend beroep op ziekenhuizen in de rest van ons land om patiënten over te nemen. "De situatie is echt zorgelijk", zeggen ziekenhuisdirecteuren.

In totaal hebben de Brabantse ziekenhuizen 120 intensive care-plekken. Die hopen ze snel tot 300 uit te breiden. Maar zelfs als dat lukt, is de vrees groot dat de stroom patiënten zo hard toeneemt dat de ziekenhuizen het straks niet meer aankunnen, waarschuwen Brabantse ziekenhuisdirecteuren.
Er liggen nu landelijk 281 mensen op de ic. Gisteren waren dat er nog 210.

Speciale tent
Bij het ziekenhuis in Uden wordt een speciale tent opgebouwd waar 20 bedden inkomen. Dat moet de druk op de Eerste Hulp verlichten. Er worden ook andere maatregelen genomen: zo wordt de reguliere zorg volledig opgeofferd aan coronabehandelingen. Dat gebeurt ook in andere Brabantse ziekenhuizen.
Ook worden patiënten verplaatst. "Als we nu niet kunnen uitplaatsen, ligt het binnen 48 uur helemaal vol", zegt de ziekenhuisdirecteur.

Echt zorgelijk
Ook in het Elisabeth Tweedstedenziekenhuis in Tilburg is de reguliere zorg enorm teruggebracht. "Ziekenhuizen tot in Zwolle en Leeuwarden bieden ons hulp aan", zegt Bart Berden van het ziekenhuis.
De ziekenhuisdirecteur is duidelijk: "Als je de situatie in Brabant bekijkt, is het echt zorgelijk."
Laast bewerkt: 4 maanden 3 weken geleden door katertje.
De volgende gebruiker (s) zei dank u: dirko

Gelieve Inloggen om deel te nemen aan het gesprek.

Meer
4 maanden 3 weken geleden - 4 maanden 3 weken geleden #55990 door katertje


In het debat afgelopen woensdag vlogen harde verwijten over en weer over de gekozen aanpak, die minder ver gaat dan in menig ander Europees land. Op basis van dat advies zei Rutte in zijn tv-toespraak van afgelopen maandag, dat het land niet op slot zal gaan en het kabinet kiest voor een scenario van beheerste verspreiding...die fasering is cruciaal met het oog op de beschikbare zorgcapaciteit. Ook moet deze aanpak leiden, aldus de premier, tot de opbouw van groepsimmuniteit.
Deze uitspraak heeft een storm van kritiek teweeg gebracht onder andere van buitenlandse experts. "Jaap van het RIVM" sprak daarop van "framing" en vond dat de kwestie van groepsimmuniteit werd opgeblazen.

Een patroon bij het RIVM. Gegeven adviezen worden even snel weer gebagatelliseerd of terzijde geschoven. Was het instituut recent nog niet van mening dat het virus niet heel besmettelijk leek en de kans klein was dat het zich hier zou verspreiden? En ook de scholen konden vorige week rustig open blijven. Van een kennis- en onderzoeksinstituut waar het landsbestuur in crisistijd op moet kunnen bouwen, mag beter worden verwacht...( in de stikstofcrisis klopten de metingen van het RIVM ook al niet en daarmee door de boeren geconfronteerd moest de woordvoerder eerst aan zijn baas toestemming vragen om iets te mogen zeggen ! )

Rutte liegt dat het echt onvoorstelbaar is
Hij heeft in zijn toespraak heel duidelijk uitgelegd wat groeps-immuniteit is, en wat de voordelen zijn, en dat dit de keuze is die het kabinet maakt. Hoe duidelijk wil je het hebben???
Leugen nr. 1
De dag erna ontkent hij glashard -vele malen- dat de groeps-immuniteit het doel is! Ook zegt hij dat de volledige lockdown zou betekenen dat het land 1 of 2 jaar op slot gaat.
Leugen nr. 2
Dat de mensen 2 jaar in hun huis moeten blijven. Dat zou dan de strategie van China zijn....!
In China is de lockdown al op de meeste plaatse opgeheven. Mensen gaan langzaam maar zeker weer aan het gewone leven beginnen

Dus twee ENORME leugens. Niet EEN kamerlid die hem corrigeert ! Zal de propaganda=pers het durven, morgen ? Tuurlijk niet!
Wilders doet goed het goed en begrijpt het. Hij pleit voor veel meer maatregelen. Baudet doet het goed, een van de weinigen die het begrijpt. Als je door een lockdown de besmetting enorm hebt teruggebracht, dan heb je daarna verplegers, IC's en mankracht genoeg om alle nieuwe zieken op te sporen en ál hun contacten in quarantaine te zetten.
Klaver kletst onzin. Klaver wil steeds 'staatsman achtig' over komen alsof hij premier is. Om te gieren als het niet zo triest was.

Seegers snapt we niks van: die denkt dat als je en lockdown hebt gehad, en als er daarna nog een enkeling het virus krijgt, dat dit betekent dat alle mensen toch weer besmettelijk zijn voor elkaar. Hij lijkt te denken dat een lockdown tijdelijk helpt. ( ca min 33)


Ik dacht niet dat Singapore een lockdown had. Ze hadden alleen enorm goede tests, controle en opsporing. En waren grif met quarantaines en boetes voor wie dacht nog wel even iets buiten te kunnen doen.

Wees verdorie transparant, speel geen spelletjes en realiseer je dat je door ons - de burgers - wordt betaald.

Aan de basis van deze politieke botsing ligt de visie van "Jaap van het RIVM en zijn jongens" dat het virus niet meer te stoppen is en een groot deel van de bevolking besmet zal raken.
We zagen minister Bruins onderuit gaan. Bezweken onder de druk. Geen minister van Volksgezondheid wil het risico lopen om duizenden over de kling te jagen voor een experiment. Deze man heeft gezondheid in zijn functie en niet de economische belangen van Rutte...!

Minister Bruins heeft zijn ontslag aan de Koning aangeboden.
Bijlagen:
Laast bewerkt: 4 maanden 3 weken geleden door katertje.
De volgende gebruiker (s) zei dank u: [Guzzi], dirko

Gelieve Inloggen om deel te nemen aan het gesprek.

Moderators: dirko